wbfi.orgHome - Wild Bird Feeding Institute

wbfi.org Profile

wbfi.org is a domain that was created on 1998-01-27,making it 27 years ago. It has several subdomains, such as members.wbfi.org , among others.

Description:WBFI: Growing the wild bird feeding hobby Subscribe to WBFI’s Monthly Message Find a Retailer Shop local to find all you need to make your home a sanctuary for birds. Enter your zip and we’ll show...

Discover wbfi.org website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site

wbfi.org Information

HomePage size: 380.697 KB
Page Load Time: 0.33161 Seconds
Website IP Address: 20.25.91.29

wbfi.org Similar Website

VIREO Bird photos - bird images worldwide
vireo.ansp.org
Wild Well Control | Wild Well Control: Emergency Response and Well Control Traini
events.wildwell.com
The National Wild Turkey Federation - The National Wild Turkey Federation
live.nwtf.org
My Swiss Kitchen - Feeding Foodies in the Alps
myswisskitchen.swisshikingvacations.com
Feeding Matters – Infant and Child Feeding Questionnaire©
questionnaire.feedingmatters.org
North Texas Food Bank | NTFB.org - North Texas Food Bank - Feeding America - North Texas Food Bank
web.ntfb.org
WarnerBros.com | Wild Wild West | Movies
wildwildwest.warnerbros.com
Soap Hope Natural Marketplace for Indigo Wild, Zum Soap, Pacifica, A Wild Soap Bar, Badger, Klean Ka
store.soaphope.com
St. Louis Area Foodbank | Member of Feeding America
slafb.convio.net
Official Minnesota Wild Website | Minnesota Wild
wild.nhl.com
Bird Feeders | Perky-Pet Wild Bird and Hummingbird feeders
fenceplanner.zarebasystems.com
Cornell Lab Bird Cams | Cornell Lab Bird Cams Cornell Lab Bird Cams
cams.allaboutbirds.org
Public Modules - Home - default - Wild Bird Feeding Institute
members.wbfi.org
Welcome to Wild Ones of West Cook - Wild Ones West Cook
westcook.wildones.org

wbfi.org PopUrls

Wild Bird Feeding Institute: Home
https://www.wbfi.org/
Wild Bird Feeding Institute: Public Modules - Home - default
https://members.wbfi.org/
Join WBFI
https://www.wbfi.org/join/
HPAI & Wild Birds 2022
https://www.wbfi.org/hpai/
WBFI Student and Teacher Resources - Wild Bird Feeding ...
https://www.wbfi.org/students/
FEEDSMART RESOURCES
https://www.wbfi.org/feedsmart/
Resources
https://www.wbfi.org/resources/
EXEC Benefits
https://www.wbfi.org/exec/
Nyjer® Seed
https://www.wbfi.org/nyjer/
Why Bird Feeding is Important - Wild Bird Feeding Institute
https://www.wbfi.org/2021/11/30/why-bird-feeding-is-important/
About Us - Wild Bird Feeding Institute
https://www.wbfi.org/about-us/
2024 Annual Meeting - Wild Bird Feeding Institute
https://www.wbfi.org/2024-annual-meeting/
2023 Annual Meeting - Wild Bird Feeding Institute
https://www.wbfi.org/2023-annual-meeting/
BIG Campaign - Wild Bird Feeding Institute
https://www.wbfi.org/big-campaign/
February, 2022 Bird Flu Update - Wild Bird Feeding Institute
https://www.wbfi.org/2022/02/18/2022birdfluupdate/

wbfi.org DNS

A wbfi.org. 900 IN A 20.25.91.29
MX wbfi.org. 3600 IN MX 0 wbfi-org.mail.eo.outlook.com.
NS wbfi.org. 7200 IN NS ns56.worldnic.com.
TXT wbfi.org. 3600 IN TXT v=spf1 include:spf.protection.outlook.com include:clientemailspf.growthzoneapp.com -all
SOA wbfi.org. 7200 IN SOA NS55.WORLDNIC.COM. namehost.WORLDNIC.COM. 124042511 10800 3600 604800 3600

wbfi.org Httpheader

Date: Tue, 14 May 2024 06:17:22 GMT
Content-Type: text/html; charset=UTF-8
Content-Length: 351383
Connection: keep-alive
Vary: Accept-Encoding, Accept-Encoding, Cookie
Cache-Control: max-age=3, must-revalidate
Last-Modified: Tue, 14 May 2024 05:18:02 GMT
X-Backend-Server: gzcms-79b7b59489-gcdjf
Strict-Transport-Security: max-age=31536000; includeSubDomains

wbfi.org Meta Info

charset="utf-8"/
content="width=device-width, initial-scale=1.0" name="viewport"/
content="IE=edge" http-equiv="X-UA-Compatible"/
content="index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1" name="robots"/
content="en_US" property="og:locale"/
content="website" property="og:type"/
content="Home" property="og:title"/
content="WBFI: Growing the wild bird feeding hobby Subscribe to WBFI’s Monthly Message Find a Retailer Shop local to find all you need to make your home a sanctuary for birds. Enter your zip and we’ll show you WBFI member products and retailers closest to you!     Search Member Details Join the Flock! WBFI is…" property="og:description"/
content="https://www.wbfi.org/" property="og:url"/
content="Wild Bird Feeding Institute" property="og:site_name"/
content="2024-02-27T21:16:34+00:00" property="article:modified_time"/
content="https://growthzonecmsprodeastus.azureedge.net/sites/1750/2024/02/Screenshot-2024-02-21-at-6.03-b226732d-d555-4ae1-98a0-ddd40cb6fbcd.54 PM-1024x614.jpeg" property="og:image"/
content="summary" name="twitter:card"/
content="Est. reading time" name="twitter:label1"/
content="5 minutes" name="twitter:data1"/
content="WordPress 6.1.1" name="generator"/
content="https://growthzonecmsprodeastus.azureedge.net/sites/1750/2021/10/cropped-WBFI-favicon-270x270.png" name="msapplication-TileImage"/
content="tI4cbeJ3ZICIcb3UJ3IDHGzKcIw9yhggnvk3ErDs62M" name="google-site-verification"/

wbfi.org Ip Information

Ip Country: United States
City Name: Washington
Latitude: 38.7095
Longitude: -78.1539

wbfi.org Html To Plain Text

Login Join Now Email (888) 839-1237 Facebook twitter LinkedIn Instagram youtube Menu HomeOur Mission WBFI Board of Directors WBFI Committees WBFI Staff WBFI Research Foundation Our Partners WBFI Awards Events 2024 Annual Meeting Events Calendar Past Events 2023 Annual Meeting 2022 Annual Meeting 2021 Annual Meeting 2019 Annual Meeting 2018 Annual Meeting Member Area Membership Kit Member Directory Member Resources Nyjer® Seed Nyjer® Compliant Companies EXEC Benefits Healthcare Coverage Find a Retailer Research Market Research Research Manuscripts Pulse of the Industry Reports Downloadable Logos Standards Logos Quality Standards Program WBFI Awards Resources Ambassador Program #FEEDSMART RESOURCES #FEEDTHEBIRDS Wild Bird Feed Product Basics Family & Class Resources Create a Sanctuary for Birds Quality Standards Program Quality Standard Amendment or Creation Suggestion QSP Participants Webinars Blog Submit Blog Content Advertise with Us! Join WBFI Apply Here WBFI: Growing the wild bird feeding hobby Subscribe to WBFI’s Monthly Message Find a Retailer Shop local to find all you need to make your home a sanctuary for birds. Enter your zip and we’ll show you WBFI member products and retailers closest to you! Search Member Details Join the Flock! WBFI is the only trade association that represents businesses that are in the wild bird feeding industry. Learn the ways membership can benefit you. Learn More WBFI Resources Explore the most current resources from the WBFI on best feeding practices, consumer research, videos, and more! Join as a member to unlock access to all materials. Learn More Allow us to reintroduce... PROJECT WILDBIRD®! We are thrilled to unveil our latest endeavor: PROJECT WILDBIRD ® ! This new website is a resurgence of WBFI’s long-held initiative to educate consumers on the benefits and best practices for bird feeding. The WBFI is committed to elevating bird feeding journeys to new heights. PROJECT WILDBIRD is the culmination of years of dedicated research by the WBFI Research Foundation , aimed at equipping bird enthusiasts with robust scientific data and insights. By bridging the gap between research findings and consumer needs, we are committed to fostering a deeper understanding and appreciation of the fascinating world of bird feeding. LEARN MORE HERE World Migratory Bird Day 2024 By courtenay@wbfi.org | May 9, 2024 World Migratory Bird Day 2024 Welcome to World Migratory Bird Day 2024! This year’s theme is Protect Insects, Protect Birds.” Why Are Insects So Important? Insects are the unsung heroes of the ecosystem. They provide an essential food source for migratory birds, who rely on them to fuel their long journeys. In fact, many bird… The Cicada Spectacle: A Feast for Feeder Birds By growthzone | April 22, 2024 The Cicada Spectacle: A Feast for Feeder Birds During the arrival of billions of cicadas in a rare double-brood event across the U.S., a hidden spectacle unfolds for bird enthusiasts and nature lovers alike. As these insects emerge from their underground slumber, they not only amaze with their deafening mating rituals but also provide a… 2024 Feeder Bird of the Year – Northern Cardinal By growthzone | April 17, 2024 2024 Feeder Bird of the Year – Northern Cardinal After an exhilarating season of fierce competition, the Northern Cardinal has emerged as our 2024 WBFI Feeder Bird of the Year! Known for its brilliant red plumage and captivating melodies, the Northern Cardinal holds a special place in the hearts of bird enthusiasts across the eastern… 1 2 3 … 23 Next » #FEEDSMART Wild Bird Feeding Institute has created resources to promote proper feeding practices for bird-feeding hobbyists and members. Learn about how you can promote smart practices such as properly cleaning your feeders to help prevent the spread of disease: How to prevent diseases at feeders Avian Flu (HPAI) Updates Create a backyard sanctuary Members of WBFI have access to an exclusive info hub of resources including the latest research on best feeding practices and additional assets that can be customized for your business. WBFI MEMBER INFO. FEED THE BIRDS. REAP THE BENEFITS. The Wild Bird Feeding Institute’s (WBFI) marketing campaign, #FeedTheBirds is an ongoing marketing initiative to highlight the benefits of the birds feeding hobby. This campaign focuses on the mental health benefits of bird feeding. Several studies prove birds help lower stress, anxiety, and depression. With technology becoming more pervasive, and society’s concern with mental wellness, we think interacting with birds is a natural remedy. GET STARTED HERE WITH FEEDING RESOURCES: The Art of Attracting Birds to Your Yard Why Bird Feeding is Important Find a WBFI Member Retailer Bird Feeding Basics Student Resources Read More Upcoming Events View Calendar The only central network of organizations supporting the Wild Bird Feeding Industry. Join the Flock! Mission: Growing the wild bird feeding hobby. WBFI advances this mission and seeks to connect people with nature by serving members and birders internationally through education, awareness, and conservation partnerships. Our network of committed members, the quality standards we uphold, our expertise, and positive relationships with key organizations drive our success. We are sustainable through membership dues, charitable donations, and programming revenue. Join Today! © 2024 Wild Bird Feeding Institute | Site by GrowthZone Red River Commodities has processed wild bird food and wildlife food products for more than 30 years. Our two wildlife food processing facilities are located in the heart of sunflower seed and grain-growing regions. We contract directly with local growers to provide the freshest possible grains at the best possible prices. We are an origin value-added manufacturer, which ensures timeliness with market conditions and decisions. All our wildlife products contain premium-grade quality seed, and we work closely with our customers to create blends, processing steps, and packaging to feed their goals. Red River Commodities is a partnered member of WBFI. Interested in advertising with us? Learn about WBFI member benefits! Resources Facebook twitter LinkedIn Instagram youtube Member Directory Member Login Get in touch Wild Bird Feeding Institute 22640 Hazel Lane, Rapid City, SD 57702 (888) 839-1237 info@wbfi.org © 2024 Wild Bird Feeding Institute. All Rights Reserved. Site by...

wbfi.org Whois

Domain Name: wbfi.org Registry Domain ID: 8ea5cf66e75a4e1891467494ef569725-LROR Registrar WHOIS Server: whois.networksolutions.com Registrar URL: http://www.networksolutions.com Updated Date: 2023-11-29T21:06:08Z Creation Date: 1998-01-27T05:00:00Z Registry Expiry Date: 2027-01-26T05:00:00Z Registrar: Network Solutions, LLC Registrar IANA ID: 2 Registrar Abuse Contact Email: domain.operations@web.com Registrar Abuse Contact Phone: +1.8777228662 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Registrant State/Province: FL Registrant Country: US Name Server: ns55.worldnic.com Name Server: ns56.worldnic.com DNSSEC: unsigned >>> Last update of WHOIS database: 2024-05-17T23:00:26Z <<<